top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|10679096|10679927|2|96,112|0,719

ILF3

Open Reading Frame (ORF)

LKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPGQSQRAEVLCHCDPGLEGPVHSRAHLGSPPRLASRAPV

Peptide

VLECLASGIVMPGQSQR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

17

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 37 15 0 0

isoCirc,CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page