top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr18|49929511|49937397|3|87,89,107|0,6740,7779

MYO5B

Open Reading Frame (ORF)

LTCFMMTRTLFLPPPLGRGHLRRSASVLPDPLPASAHGDPECHDTSLCPLHQAQR

Peptide

TLFLPPPLGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

31 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page