top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr18|49929511|49937397|3|87,68,123|0,6740,7763

MYO5B

Open Reading Frame (ORF)

LFHDDKDPVPATTPGKGSSSKISVRSARPPMKVSNTLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSSSH

Peptide

VSNTLNATTPHYVR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

14

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

9 34 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Exist in Short-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page