top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr18|42015475|42029441|2|91,84|0,13882

PIK3C3

Open Reading Frame (ORF)

LELAAQQTFVDRLVHLMKAVQRESGNRKKKLPNYNQPPSFSLFTSSCIKNKRSSRWRKSGTGCTTDICRSVGASNEGSTTRKWKS

Peptide

SVGASNEGSTTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

12

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 37 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page