top of page

CircRNA

Gene

chr18|31638643|31666372|4|117,125,65,82|0,6711,19332,27647

B4GALT6

Open Reading Frame (ORF)

LRFMSLNSQHISLYGTSSRYNVERKCENNRSYDQAVSPGKLHILTIPPLSRKAALYARIPQCQCKRSQF

Peptide

SYDQAVSPGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

15 16 0 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page