top of page

CircRNA

Gene

chr17|9709955|9712132|2|101,45|0,2132

USP43

Open Reading Frame (ORF)

LDGQWYSYDDSTVEPLREDEVNTRGAYILTLPSSPTASAIRKRPTAGTLWMASGTVMMTARWNRFEKMRSTPEGLIS

Peptide

RPTAGTLWMASGTVMMTARWNR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Junction

Junction

Peptide Length

Frame

Start Codon

22

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 3 64 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page