top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|81869840|81871335|2|117,38|0,1457

ARHGDIA

Open Reading Frame (ORF)

LSRSPQPSSWPRLQRRTRRMSTRSTTSPRAGGILNRAAEPSGVPTQAKLEHG

Peptide

MSTRSTTSPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 29 2 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page