top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|80891719|80893865|2|135,89|0,2057

RPTOR

Open Reading Frame (ORF)

LHRGPAVHRRGKELRLAFSSNHRYGVFSSPRMRSISCPSRPSTRCAAPAPTPPSTPSSELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTGMASSPPRE

Peptide

MRSISCPSRPSTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

13

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 40 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page