top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|75921516|75923556|3|44,152,371|0,428,1669

ENSG00000267426,FBF1

Open Reading Frame (ORF)

LTGWASRTRTWTCSLPHPPERPIGKVQCLSRPQCLLLRASTPRQLGCPPPGQSHQLKVQGPLPKPARLPSCEPPRRRKRTG

Peptide

LTGWASR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

7

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page