top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|75832965|75835063|4|80,69,66,21|0,1109,1359,2077

UNC13D

Open Reading Frame (ORF)

LVPLGELLQSALAGLGHEIRTGVRTLAEQLEVGIAKHIQKLVGVRESVLPEDAILPLMKFLEVELCYMNTNLVQENFSSWCPWVNCCRARWPGWAMRSALASAPWPSSWRWASPSTSRNWWASGSLSCLRMPFCP

Peptide

WPGWAMRSALASAPWPSSWR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

20

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 53 8 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page