top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|72829456|72829738|1|282|0

ENST00000583916

Open Reading Frame (ORF)

MERGKRGGTRICPESQTCTLVGPLSMSALIRHVCFLLSILPFPLPLS

Peptide

ICPESQTCTLVGPLSMSALIR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

21

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

64 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page