top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|64091944|64092216|1|272|0

ENST00000577567.5

Open Reading Frame (ORF)

LAKAPAMGPERSQVCRVLPSNTPHTLMQAQRHHYRQHQEHFSRQGYS

Peptide

VLPSNTPHTLMQAQRHHYR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

19

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

10 48 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page