top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|537085|553462|3|91,79,83|0,14786,16294

VPS53

Open Reading Frame (ORF)

LIERINLTGEMDTFSTVISSSIQLLVQDLDAACDPALTAMSKMQWQNVEHVGDQSPYVTSVILHIKQNVPIIPRRKTQRKSGCKSD

Peptide

QNVPIIPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

8

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 19 6 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page