top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|50686447|50687368|2|208,38|0,883

ABCC3

Open Reading Frame (ORF)

LLSTLPPEHAPPRHMPTGSFPKAPHYPNGWDSLATHAALKTKYAS

Peptide

HMPTGSFPK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

8 20 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page