top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|48112030|48113401|3|33,87,101|0,543,1270

SNX11

Open Reading Frame (ORF)

MRAPGTLMWIIRYSSIPTAKPLLPRLPVCGAATVSSCG

Peptide

APGTLMWIIR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA,PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 31 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page