top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|44321699|44322528|2|68,110|0,719

SLC25A39

Open Reading Frame (ORF)

LQWCPGASVPVPKWCPLCHLVSRPYPLHWHHGCLREDREARGHQDPLERPPRHPGSASCIAMVSWSLCTCAQMVPAVPPGFKTLPASLAPWMPS

Peptide

LQWCPGASVPVPKWCPLCHLVSRPYPLHWHHGCLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

35

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

94 12 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page