top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|44037489|44040256|2|49,110|0,2657

LSM12

Open Reading Frame (ORF)

MARKKHRSHGRTCQQSTDREGGEAEPGLCNQCWCLSRGPAALPDHSQDH

Peptide

GPAALPDHSQDH

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

12

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

33 3 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page