top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|4282797|4307123|4|124,179,98,103|0,6432,13919,24223

UBE2G1

Open Reading Frame (ORF)

MTMISTDGKSLLLALQIHFMKVVFLRLILLSQKIIPSDLLK

Peptide

SLLLALQIHFMKVVFLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

17

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

31 21 0 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page