top of page

CircRNA

Gene

chr17|42728824|42730918|2|94,55|0,2039

EZH1

Open Reading Frame (ORF)

MRLRQLKRLQANMGAKLDTCSAVVSCHSPEEQRHTPNVSLTGKEK

Peptide

HTPNVSLTGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

4 27 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page