top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|39708320|39710481|2|199,119|0,2042

ERBB2

Open Reading Frame (ORF)

LQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLASVSCTAQPWSPTTQTRLSPCPIPRAGIHSAPAV

Peptide

ELQLASVSCTAQPWSPTTQTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

21

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

10 54 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page