top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|39419716|39423821|2|202,53|0,4052

MED1

Open Reading Frame (ORF)

LCQKNYSERRTPSFSSITSANSVDLPACSSWSAALLFPQQGCSSSRWPKSTGNPC

Peptide

WPKSTGNPC

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

9

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 27 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page