top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|3662547|3662703|1|156|0

SLC30A7

Open Reading Frame (ORF)

LGASRGFTVTPKKAHAPQGPTPVLPDTPTDVVLWVSLRPLPGGS

Peptide

GFTVTPK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page