top of page

CircRNA

Gene

chr17|29574451|29574674|1|223|0

GIT1

Open Reading Frame (ORF)

LVPTPVEPLRMGRWGGRSFCPPHSMHLPSVYSISPLPRTSLAIGAGPLQTLIPTPTEPLAQVPLVLPHSLAARCPGAHPCRAPKDGEVGGQELLSPTFHAPPLCI

Peptide

LVPTPVEPLRMGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

13

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

40 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page