top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|28122602|28191219|2|134,115|0,68502

NLK

Open Reading Frame (ORF)

LEEFIPVTLSLSPIPNLMTLSRRTSVLSDRLKVSNRSKRWKESSAQKDAQRLPESGLLQKGLPGIEDVVFF

Peptide

LEEFIPVTLSLSPIPNLMTLSR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

22

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 67 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page