top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|2690326|2690635|1|309|0

CLUH

Open Reading Frame (ORF)

LPRTLLRACRDREGARRTASQRPRHQGARLREKGASLRAEEEARPSSSTSHPTPPPCPPGSLACLPRRRCFCAGSMNR

Peptide

LPRTLLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

7

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page