top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|20205320|20205435|1|115|0

SPECC1

Open Reading Frame (ORF)

LMNLLQERVKNEEPTTQEGKILSSASREGRAAKSRK

Peptide

NEEPTTQEGKILSSASR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

17

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

30 22 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page