top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|20204332|20205912|2|144,68|0,1512

SPECC1

Open Reading Frame (ORF)

LSQERGLCHVVPPTPGNQCPVQLLPTLPLMSSDKNY

Peptide

LSQERGLCHVVPPTPGNQCPVQLLPTLPLMSSDK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

34

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

87 16 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Exist in Short-Read

TRUE

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page