top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|18099050|18100639|4|27,91,73,71|0,582,1312,1518

DRG2

Open Reading Frame (ORF)

MPPRERCRGLCWRRSWSLWASASTSTSLTSTSSPRKVVASPLTRQSR

Peptide

VVASPLTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

8

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 0 25 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page