top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|17795808|17795968|1|160|0

RAI1

Open Reading Frame (ORF)

LMGSELQGIPPPRTPLWPRSPTSLLCPRRPSQRKSLCHGAKAYGAVGCTGG

Peptide

SPTSLLCPR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Alternative

Peptide Length

Frame

Start Codon

9

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

28 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page