top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|9105740|9105869|1|129|0

HAPSTR1

Open Reading Frame (ORF)

MFWSFTLWVSLNSCVWQAQGHGKRIWYFEAGLSL

Peptide

MFWSFTLWVSLNSCVWQAQGHGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

23

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

3 35 26

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page