top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|89561598|89561687|1|89|0

RPL13

Open Reading Frame (ORF)

LQANVQRLKEWPGPSAFLWIRGGGTSPRSPCRPTCSG

Peptide

EWPGPSAFLWIR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

12

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

4 33 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page