top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|87975047|87984259|2|53,84|0,9128

BANP

Open Reading Frame (ORF)

LNSFVLTGQNKQHSPIQVPMVAGSPLGATQTCNKVRW

Peptide

LNSFVLTGQNK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

11

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

26 8 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page