top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|87726764|87755292|3|54,137,99|0,21908,28429

KLHDC4

Open Reading Frame (ORF)

LYNELYVYNTRKDTWTKVDIPSPPPRRCAHQAVVVPQGGGQLWVFGGEFASPNGEQFYHYKDLWVLHLATKTWEQVKCPSLPRAASSSMGATRNRLFCITSSMSTIPERTPGPKLTSPVHLRGAVLTRRW

Peptide

AASSSMGATR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 31 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page