top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|87336164|87342898|2|100,22|0,6712

FBXO31

Open Reading Frame (ORF)

MSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTRCPAGGRRSFGRG

Peptide

FIYTRCPAGGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

11

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 13 21 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page