top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|83953800|83953987|1|187|0

NM_182981

Open Reading Frame (ORF)

LQETLGSRCAALGRGLVCDKWQVPLAWTDHPSPHPWRSQRLSFSQEAQECGGLGGRPLGGWGAAGDPGLQVCGTGARARL

Peptide

GLVCDKWQVPLAWTDHPSPHPWR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

23

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

51 19 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page