top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|77198346|77198548|1|202|0

MON1B

Open Reading Frame (ORF)

LSTLEMCVGVCLWPVIVSLSNGARSEGPPMREMVAAARRAGCFPCPVMHLPLWGNP

Peptide

EMVAAARR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

8

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page