top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|76539718|76553907|5|134,88,68,46,72|0,984,13564,13737,14117

CNTNAP4

Open Reading Frame (ORF)

MWTRILHWQVRRASQAASLHLALMPHQGKGHTRLQIILEQ

Peptide

ASQAASLHLALMPHQGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

17

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 23 29 0 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page