top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|74912197|74916259|3|165,125,133|0,3672,3929

WDR59

Open Reading Frame (ORF)

MVLMSSLRVFPFCRNLRRPCTLKIQITSTLQAMGRKKP

Peptide

MVLMSSLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

8

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page