top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|69930139|69931566|3|119,76,58|0,1012,1369

WWP2

Open Reading Frame (ORF)

LPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEGTSSAPRMGDEIHQRGGAILCGPQYPHHHL

Peptide

QTLFEGTSSAPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

12

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 16 21 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page