top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|57752563|57753166|3|38,151,90|0,214,513

KATNB1

Open Reading Frame (ORF)

LGPSGASSSTQTAAACTAAARTHCVSTAGNLSGALMWSSSTGARWPTWPSAMTS

Peptide

LGPSGASSSTQTAAACTAAAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

21

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

13 51 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page