top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|47223|47329|1|106|0

POLR3K

Open Reading Frame (ORF)

MAYLPGRVDEVMNVWEFFLWWKDKPFEVKSQGVRKYGLSARQGG

Peptide

YGLSARQGG

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

27 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page