top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|30067598|30069328|4|63,55,161,23|0,1047,1219,1707

ALDOA

Open Reading Frame (ORF)

LGNTPPQPSPSWKMPMFWPVMPVSASRMALCPSWSG

Peptide

LGNTPPQPSPSWKMPMFWPVMPVSASR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

27

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 80 2 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page