top of page

CircRNA

Gene

chr16|29146503|29146753|1|250|0

T129736

Open Reading Frame (ORF)

LNLSPESRWAAPAARPRRAVPQGWPGPQCDGAGLTRRRPPEVPFTSFVQLDSLILQGGKSN

Peptide

AVPQGWPGPQCDGAGLTRR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

19

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

58 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page