top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|27346466|27355907|2|95,74|0,9367

IL4R

Open Reading Frame (ORF)

LTVHTNVSDTLLLTWSNPYPPDNYLLLGVSVSCIVILAVCLLCYVSITNETQGPRKPDSSHQCLRHSAADLEQPVSP

Peptide

KPDSSHQCLRHSAADLEQPVSP

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

22

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

66 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Exist in Short-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page