top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|265280|265463|1|183|0

FAM234A

Open Reading Frame (ORF)

LGHAAPHPYPVPSPCQLLPRPERPSRRKNQGVPGTGRPPPHPGPAHTRQPS

Peptide

KNQGVPGTGRPPPHPGPAHTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

21

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

45 19 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page