top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|1685438|1698843|4|149,38,32,33|0,6404,12390,13372

JPT2

Open Reading Frame (ORF)

LEVQKKLLLPAGLIGWHLIFLDQQKNLRTYPRGQIPQGVKEVVSLTNQPPEGEEPKSDLKAARSIPAGAEPGP

Peptide

AARSIPAGAEPGP

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

13

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

7

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 1 2 4 2 2 2 2

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page