top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|11838000|11838113|1|113|0

RSL1D1

Open Reading Frame (ORF)

MPQERSLQQRVLIPAHLVGRKERLCQHLRPQKLQNSKTCHRKEVSSKES

Peptide

LQNSKTCHR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

9

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

7 21 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page