top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|89806193|89806361|1|168|0

ANPEP

Open Reading Frame (ORF)

LSFLLWMMMTSVASLQVKRTVLEPLKTYRPLSLGVRYGLSVTR

Peptide

YGLSVTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

7

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

21 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page