top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|89797307|89797428|1|121|0

ENST00000559761

Open Reading Frame (ORF)

LPHAASSLTSSVPAHSPPCPSGSLFHLRALRREPDKALYCFAPRSLLTHLLSACSLTSMSLRLALSPACSQERT

Peptide

ALYCFAPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

8

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

3 19 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page