top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|84784870|84790872|2|25,168|0,5834

ZNF592

Open Reading Frame (ORF)

LPGMPNAAAQPVQFLCPPADSCTQVPLLLPGVWGPLPLCLLPDPCKGELPALCPQGQQRRQRG

Peptide

GELPALCPQGQQR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

13

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 28 12 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page